Home Tools
Log in
Cart

CXCR3 Protein, Mouse, Recombinant (His & KSI)

Catalog No. TMPH-02612
Synonyms: CXC-R3, CKR-L2, CXCR3, CD183, GPR9, Interferon-inducible protein 10 receptor, IP-10 receptor, G protein-coupled receptor 9, CXCR-3, C-X-C chemokine receptor type 3

Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CXCR3 Protein, Mouse, Recombinant (His & KSI)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21.
Species Mouse
Expression System E. coli
Tag N-terminal 6xHis-KSI-tagged
Accession Number O88410
Synonyms CXC-R3, CKR-L2, CXCR3, CD183, GPR9, Interferon-inducible protein 10 receptor, IP-10 receptor, G protein-coupled receptor 9, CXCR-3, C-X-C chemokine receptor type 3
Amino Acid MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-52 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 21.3 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CXCR3 Protein, Mouse, Recombinant (His & KSI) CXC-R3 CKR-L2 CXCR3 CD183 GPR9 Interferon-inducible protein 10 receptor IP-10 receptor G protein-coupled receptor 9 CXCR-3 C-X-C chemokine receptor type 3 recombinant recombinant-proteins proteins protein

 

TargetMol