Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21. |
Species | Mouse |
Expression System | E. coli |
Tag | N-terminal 6xHis-KSI-tagged |
Accession Number | O88410 |
Synonyms | CXC-R3, CKR-L2, CXCR3, CD183, GPR9, Interferon-inducible protein 10 receptor, IP-10 receptor, G protein-coupled receptor 9, CXCR-3, C-X-C chemokine receptor type 3 |
Amino Acid | MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 1-52 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 21.3 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CXCR3 Protein, Mouse, Recombinant (His & KSI) CXC-R3 CKR-L2 CXCR3 CD183 GPR9 Interferon-inducible protein 10 receptor IP-10 receptor G protein-coupled receptor 9 CXCR-3 C-X-C chemokine receptor type 3 recombinant recombinant-proteins proteins protein