Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Small-inducible cytokine B10, SCYB10, INP10, CXCL10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein (Gamma-IP10;IP-10)

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $79 | - | In Stock | |
| 10 μg | $126 | 20 days | 20 days | |
| 20 μg | $208 | - | In Stock | |
| 50 μg | $313 | 20 days | 20 days | |
| 100 μg | $429 | 20 days | 20 days | |
| 200 μg | $663 | 20 days | 20 days | |
| 500 μg | $1,180 | 20 days | 20 days | |
| 1 mg | $1,850 | 20 days | 20 days |
| Description | CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P02778 |
| Amino Acid | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Construction | 22-98 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer,50% glycerol |
| Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Small-inducible cytokine B10, SCYB10, INP10, CXCL10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein (Gamma-IP10;IP-10) |
| Research Background |
| Molecular Weight | 12.6 kDa as predicted |
| Relative Density. | no data available |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.