Shopping Cart
Remove All
Your shopping cart is currently empty
CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $79 | - | In Stock | |
| 10 μg | $126 | 20 days | 20 days | |
| 20 μg | $208 | - | In Stock | |
| 50 μg | $313 | 20 days | 20 days | |
| 100 μg | $429 | 20 days | 20 days | |
| 200 μg | $663 | 20 days | 20 days | |
| 500 μg | $1,180 | 20 days | 20 days | |
| 1 mg | $1,850 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P02778 |
| Synonyms | Small-inducible cytokine B10,SCYB10,INP10,CXCL10,C-X-C motif chemokine 10,10 kDa interferon gamma-induced protein (Gamma-IP10;IP-10) |
| Amino Acid | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Construction | 22-98 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 12.6 kDa as predicted |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer,50% glycerol |
| Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.