CXCL10 Protein, Human, Recombinant (His)

Catalog No. TMPH-03770 Copy Product Info

CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778.

CXCL10 Protein, Human, Recombinant (His)

Catalog No. TMPH-03770

Copy Product Info

CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778.

Pack Size	Price	USA Stock	Global Stock
5 μg	$79	-	In Stock
10 μg	$126	20 days	20 days
20 μg	$208	-	In Stock
50 μg	$313	20 days	20 days
100 μg	$429	20 days	20 days
200 μg	$663	20 days	20 days
500 μg	$1,180	20 days	20 days
1 mg	$1,850	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P02778
Synonyms	Small-inducible cytokine B10,SCYB10,INP10,CXCL10,C-X-C motif chemokine 10,10 kDa interferon gamma-induced protein (Gamma-IP10;IP-10)
Amino Acid	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Construction	22-98 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	12.6 kDa as predicted
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer,50% glycerol
Reconstitution	A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization.