Home Tools
Log in
Cart

Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His)

Catalog No. TMPH-00179
Synonyms: bt2, cryIA(b), 130 kDa crystal protein, cryIC1, cry1Ab, cry1A(b), cry-1-2, Insecticidal delta-endotoxin CryIA(b), Crystaline entomocidal protoxin, Pesticidal crystal protein Cry1Ab

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 397.00
100 μg 20 days $ 769.00
1 mg 20 days $ 2,760.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.
Species Bacillus thuringiensis subsp. kurstaki
Expression System P. pastoris (Yeast)
Tag N-6xHis
Accession Number P0A370
Synonyms bt2, cryIA(b), 130 kDa crystal protein, cryIC1, cry1Ab, cry1A(b), cry-1-2, Insecticidal delta-endotoxin CryIA(b), Crystaline entomocidal protoxin, Pesticidal crystal protein Cry1Ab
Amino Acid HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Construction 1022-1155 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 17.3 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) bt2 cryIA(b) 130 kDa crystal protein cryIC1 cry1Ab cry1A(b) cry-1-2 Insecticidal delta-endotoxin CryIA(b) Crystaline entomocidal protoxin Pesticidal crystal protein Cry1Ab recombinant recombinant-proteins proteins protein

 

TargetMol