Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 397.00 | |
100 μg | 20 days | $ 769.00 | |
1 mg | 20 days | $ 2,760.00 |
Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370. |
Species | Bacillus thuringiensis subsp. kurstaki |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | P0A370 |
Synonyms | bt2, cryIA(b), 130 kDa crystal protein, cryIC1, cry1Ab, cry1A(b), cry-1-2, Insecticidal delta-endotoxin CryIA(b), Crystaline entomocidal protoxin, Pesticidal crystal protein Cry1Ab |
Amino Acid | HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
Construction | 1022-1155 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 17.3 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) bt2 cryIA(b) 130 kDa crystal protein cryIC1 cry1Ab cry1A(b) cry-1-2 Insecticidal delta-endotoxin CryIA(b) Crystaline entomocidal protoxin Pesticidal crystal protein Cry1Ab recombinant recombinant-proteins proteins protein