Shopping Cart
Remove All
Your shopping cart is currently empty
Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His & SUMO)
(Synonyms: Pesticidal crystal protein Cry1Ab, Insecticidal delta-endotoxin CryIA(b), Crystaline entomocidal protoxin, cryIC1, cryIA(b), cry1Ab, cry1A(b), cry-1-2, bt2, 130 kDa crystal protein) Copy Product InfoSynonyms: Pesticidal crystal protein Cry1Ab, Insecticidal delta-endotoxin CryIA(b), Crystaline entomocidal protoxin, cryIC1, cryIA(b), cry1Ab, cry1A(b), cry-1-2, bt2, 130 kDa crystal protein
Catalog No. TMPH-00180 Copy Product Info
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 31.3 kDa and the accession number is P0A370.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:90%
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 31.3 kDa and the accession number is P0A370. |
| Species | Bacillus thuringiensis subsp. kurstaki |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P0A370 |
| Amino Acid | HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
| Construction | 1022-1155 aa |
| Protein Purity | > 90% as determined by SDS-PAGE.  |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Pesticidal crystal protein Cry1Ab, Insecticidal delta-endotoxin CryIA(b), Crystaline entomocidal protoxin, cryIC1, cryIA(b), cry1Ab, cry1A(b), cry-1-2, bt2, 130 kDa crystal protein |
| Research Background | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
| Molecular Weight | 31.3 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His & SUMO) chemical structure | Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.