CCL21c Protein, Mouse, Recombinant

Name: CCL21c Protein, Mouse, Recombinant
Brand: TargetMol
SKU: TMPH-04224
Price: 147 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Thymus-derived chemotactic agent 4 (TCA4), Small-inducible cytokine A21c, Scya21c, Ccl21c, C-C motif chemokine 21c, Beta-chemokine exodus-2, 6Ckine) Copy Product Info

Synonyms: Thymus-derived chemotactic agent 4 (TCA4), Small-inducible cytokine A21c, Scya21c, Ccl21c, C-C motif chemokine 21c, Beta-chemokine exodus-2, 6Ckine

Catalog No. TMPH-04224 Copy Product Info

Purity: 98.01%

CCL21c Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P86793.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	-	In Stock
10 µg	$223	-	In Stock
20 µg	$382	-	In Stock
50 µg	$739	7-10 days	7-10 days
100 µg	$1,220	7-10 days	7-10 days
200 µg	$1,720	7-10 days	7-10 days
500 µg	$2,730	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:98.01%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine T-lymphocytes is in a concentration range of 10-100 ng/ml.
Description	CCL21c Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P86793.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	P86793
Amino Acid	SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Construction	24-133 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl , pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Thymus-derived chemotactic agent 4 (TCA4), Small-inducible cytokine A21c, Scya21c, Ccl21c, C-C motif chemokine 21c, Beta-chemokine exodus-2, 6Ckine

Chemical Properties

Molecular Weight

12.1 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.