Home Tools
Log in
Cart

Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar)

Catalog No. TMPH-00246
Synonyms: ns4.9, 4.9 kDa accessory protein, Non-structural protein of 4.9 kDa

Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar) is expressed in Yeast.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 397.00
100 μg 20 days $ 769.00
500 μg 20 days $ 1,780.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar) is expressed in Yeast.
Species BCoV
Expression System Yeast
Tag C-terminal 6xHis-sumostar-tagged
Accession Number P15778
Synonyms ns4.9, 4.9 kDa accessory protein, Non-structural protein of 4.9 kDa
Amino Acid MTTKFVFDLLAPDDILHPFNHVKLIIRPIEVEHIIIATTMPAV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-43 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 17.7 kDa as predicted
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar) ns4.9 4.9 kDa accessory protein Non-structural protein of 4.9 kDa recombinant recombinant-proteins proteins protein

 

TargetMol