Shopping Cart
Remove All
Your shopping cart is currently empty
Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 6.3 kDa and the accession number is P22052.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $86 | 20 days | 20 days | |
| 10 μg | $138 | 20 days | 20 days | |
| 20 μg | $231 | 20 days | 20 days | |
| 50 μg | $348 | 20 days | 20 days | |
| 100 μg | $480 | 20 days | 20 days | |
| 200 μg | $743 | 20 days | 20 days | |
| 500 μg | $1,330 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 6.3 kDa and the accession number is P22052. |
| Species | BCoV |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis |
| Accession Number | P22052 |
| Synonyms | ns4.8,Non-structural protein of 4.8 kDa,4.8 kDa accessory protein |
| Amino Acid | MPMATTIDGTDYTNIMPSTVSTTVYLGCSIGIDTSTTGFTCFSRY |
| Construction | 1-45 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 6.3 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.