Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His)

Name: Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His)
Brand: TargetMol
SKU: TMPH-00245
Rating: 4.5 (1 reviews)

(Synonyms: ns4.8, Non-structural protein of 4.8 kDa, 4.8 kDa accessory protein) Copy Product Info

Synonyms: ns4.8, Non-structural protein of 4.8 kDa, 4.8 kDa accessory protein

Catalog No. TMPH-00245 Copy Product Info

Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 6.3 kDa and the accession number is P22052.

Pack Size	Price	USA Stock	Global Stock
5 µg	$86	20 days	20 days
10 µg	$138	20 days	20 days
20 µg	$231	20 days	20 days
50 µg	$348	20 days	20 days
100 µg	$480	20 days	20 days
200 µg	$743	20 days	20 days
500 µg	$1,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 6.3 kDa and the accession number is P22052.
Species	BCoV
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	P22052
Amino Acid	MPMATTIDGTDYTNIMPSTVSTTVYLGCSIGIDTSTTGFTCFSRY
Construction	1-45 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	ns4.8, Non-structural protein of 4.8 kDa, 4.8 kDa accessory protein

Chemical Properties

Molecular Weight

6.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

ns 4.8

Related Tags: Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) chemical structure | Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) molecular weight