Home Tools
Log in
Cart

Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His)

Catalog No. TMPH-00245
Synonyms: 4.8 kDa accessory protein, Non-structural protein of 4.8 kDa, ns4.8

Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) is expressed in Yeast with C-terminal 6xHis tag. The predicted molecular weight is 6.3 kDa. Accession number: P22052

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 231.00
100 μg 20 days $ 437.00
500 μg 20 days $ 1,210.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) is expressed in Yeast with C-terminal 6xHis tag. The predicted molecular weight is 6.3 kDa. Accession number: P22052
Species BCoV
Expression System Yeast
Tag C-terminal 6xHis-tagged
Accession Number P22052
Synonyms 4.8 kDa accessory protein, Non-structural protein of 4.8 kDa, ns4.8
Amino Acid MPMATTIDGTDYTNIMPSTVSTTVYLGCSIGIDTSTTGFTCFSRY Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-45 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 6.3 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Bovine coronavirus (strain Mebus) Non-structural Protein 4b (His) 4.8 kDa accessory protein Non-structural protein of 4.8 kDa ns4.8 recombinant recombinant-proteins proteins protein

 

TargetMol