Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 491.00 | |
100 μg | 20 days | $ 1,370.00 | |
500 μg | 20 days | $ 1,960.00 |
Description | Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus. |
Species | Tityus serrulatus |
Expression System | Baculovirus |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Accession Number | P15226 |
Synonyms | Toxin II-11, Beta-like toxin Ts1, Ts7, Beta-mammal/insect toxin Ts1, PT-Mice-Ins-beta NaTx6.1, Toxin VII, Tityustoxin VII, Ts VII, Toxin III-10 |
Amino Acid | KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 21-81 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 10.8 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc) Toxin II-11 Beta-like toxin Ts1 Ts7 Beta-mammal/insect toxin Ts1 PT-Mice-Ins-beta NaTx6.1 Toxin VII Tityustoxin VII Ts VII Toxin III-10 recombinant recombinant-proteins proteins protein