Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc)

Catalog No. TMPH-03626

Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.8 kDa and the accession number is P15226.

Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc)

Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc)

Catalog No. TMPH-03626
Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.8 kDa and the accession number is P15226.
Pack SizePriceAvailabilityQuantity
20 μg$49120 days
100 μg$1,50020 days
500 μg$2,15020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.8 kDa and the accession number is P15226.
Species
Tityus serrulatus
Expression System
Baculovirus Insect Cells
TagN-10xHis, C-Myc
Accession NumberP15226
Synonyms
TsTX-I,Toxin T2-IV,Toxin III-10,Toxin II-11,Toxin gamma (T-gamma;TiTx gamma;Toxin-g),Tityustoxin VII (Toxin VII;Ts VII;Ts7;TsTX-VII),PT-Mice-Ins-beta NaTx6.1,Beta-mammal/insect toxin Ts1,Beta-like toxin Ts1
Amino Acid
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Construction
21-81 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight10.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords