Shopping Cart
Remove All
Your shopping cart is currently empty
Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (E. coli, His & Myc)
(Synonyms: TsTX-I, Toxin T2-IV, Toxin III-10, Toxin II-11, Toxin gamma (T-gamma;TiTx gamma;Toxin-g), Tityustoxin VII (Toxin VII;Ts VII;Ts7;TsTX-VII), PT-Mice-Ins-beta NaTx6.1, Beta-mammal/insect toxin Ts1, Beta-like toxin Ts1) Copy Product InfoSynonyms: TsTX-I, Toxin T2-IV, Toxin III-10, Toxin II-11, Toxin gamma (T-gamma;TiTx gamma;Toxin-g), Tityustoxin VII (Toxin VII;Ts VII;Ts7;TsTX-VII), PT-Mice-Ins-beta NaTx6.1, Beta-mammal/insect toxin Ts1, Beta-like toxin Ts1
Catalog No. TMPH-03627 Copy Product Info
Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 14.3 kDa and the accession number is P15226.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 14.3 kDa and the accession number is P15226. |
| Species | Tityus serrulatus |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P15226 |
| Amino Acid | KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC |
| Construction | 21-81 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | TsTX-I, Toxin T2-IV, Toxin III-10, Toxin II-11, Toxin gamma (T-gamma;TiTx gamma;Toxin-g), Tityustoxin VII (Toxin VII;Ts VII;Ts7;TsTX-VII), PT-Mice-Ins-beta NaTx6.1, Beta-mammal/insect toxin Ts1, Beta-like toxin Ts1 |
| Research Background | Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland. |
| Molecular Weight | 14.3 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Keywords
β-mammal/insect toxin Ts1β-like toxin Ts1β-like toxin Ts 1T-γTγToxinVIIToxin γ (T-γ;TiTx γ;Toxin-g)Toxin VIIToxin T2IVToxin III10Toxin II11Toxin G (T-G;TiTx G;Toxin-g)T-gammaTgammaT-GTGPT-Mice-Ins-β NaTx6.1PT-Mice-Ins-b NaTx6.1b-mammal/insect toxin Ts1b-like toxin Ts1b-like toxin Ts 1Beta-like toxin Ts 1
Preview
Related Tags: Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (E. coli, His & Myc) chemical structure | Beta-mammal/insect toxin Ts1 Protein, Tityus serrulatus, Recombinant (E. coli, His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.