Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

ATP4B Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01894

ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164.

ATP4B Protein, Human, Recombinant

ATP4B Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01894
ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$13220 days20 days
10 μg$21720 days20 days
20 μg$36220 days20 days
50 μg$47920 days20 days
100 μg$59820 days20 days
200 μg$85620 days20 days
500 μg$1,37020 days20 days
1 mg$1,98020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP51164
Synonyms
Proton pump beta chain,Potassium-transporting ATPase subunit beta,Gastric H(+)/K(+) ATPase subunit beta,ATP4B
Amino Acid
CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Construction
58-291 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight26.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords