Shopping Cart
Remove All
Your shopping cart is currently empty
ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $132 | 20 days | 20 days | |
| 10 μg | $217 | 20 days | 20 days | |
| 20 μg | $362 | 20 days | 20 days | |
| 50 μg | $479 | 20 days | 20 days | |
| 100 μg | $598 | 20 days | 20 days | |
| 200 μg | $856 | 20 days | 20 days | |
| 500 μg | $1,370 | 20 days | 20 days | |
| 1 mg | $1,980 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P51164 |
| Synonyms | Proton pump beta chain,Potassium-transporting ATPase subunit beta,Gastric H(+)/K(+) ATPase subunit beta,ATP4B |
| Amino Acid | CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK |
| Construction | 58-291 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 26.6 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.