ATP4B Protein, Human, Recombinant

Catalog No. TMPH-01894 Copy Product Info

ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164.

ATP4B Protein, Human, Recombinant

Catalog No. TMPH-01894

Copy Product Info

ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164.

Pack Size	Price	USA Stock	Global Stock
5 μg	$132	20 days	20 days
10 μg	$217	20 days	20 days
20 μg	$362	20 days	20 days
50 μg	$479	20 days	20 days
100 μg	$598	20 days	20 days
200 μg	$856	20 days	20 days
500 μg	$1,370	20 days	20 days
1 mg	$1,980	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ATP4B Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 26.6 kDa and the accession number is P51164.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P51164
Synonyms	Proton pump beta chain,Potassium-transporting ATPase subunit beta,Gastric H(+)/K(+) ATPase subunit beta,ATP4B
Amino Acid	CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Construction	58-291 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	26.6 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle.