Home Tools
Log in
Products Inhibitors Libraries Recombinant Proteins Kits Services Contact Us
Cart
Peptides Monoclonal Antibodies Dye Reagents PROTAC Virtual Screening TargetMol Kits Cell Counting Kit-8 (CCK-8) Inhibitor Cocktails Natural Products Phenols Alkaloids Flavonoids
Inhibitors Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK
Membrane transporter/Ion channel Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Compound Libraries Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD Drug-like Compound Libraries Fragment Libraries Custom Compound Library
Signaling Pathways Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling
DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK Membrane transporter/Ion channel
Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome
Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries
Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD
Drug-like Compound Libraries Compound Libraries for HTS/HCS
Fragment Libraries General Fragment Libraries Characteristic Fragment Libraries Custom Compound Library
TargetMol
Cytokines and Growth Factors •   Cytokines •   Growth Factors Receptor Proteins •   Fc Receptors •   Cytokines and Growth Factor Receptors
CD Proteins •   T Cell CD Proteins •   B Cell CD Proteins Immune Checkpoint Proteins •   Co-inhibitory Immune Checkpoint Proteins •   Co-stimulatory Immune Checkpoint Proteins
CAR-T Therapy Target Proteins •   Hematologic Malignancies Target Proteins •   Solid Tumors Target Proteins Enzymes •   Oxidoreductases,EC 1 •   Transferases,EC 2
Viral Proteins •   Coronavirus (CoV) Proteins •   Influenza Proteins Fluorescent Proteins Others

ATP4B Protein, Human, Recombinant (GST)

Catalog No. TMPH-01893
Synonyms: Proton pump beta chain, Gastric H(+)/K(+) ATPase subunit beta, ATP4B, Potassium-transporting ATPase subunit beta

The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ATP4B Protein, Human, Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle.
Species Human
Expression System E. coli
Tag N-terminal GST-tagged
Accession Number P51164
Synonyms Proton pump beta chain, Gastric H(+)/K(+) ATPase subunit beta, ATP4B, Potassium-transporting ATPase subunit beta
Amino Acid CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 58-291
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 53.6 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ATP4B Protein, Human, Recombinant (GST) Proton pump beta chain Gastric H(+)/K(+) ATPase subunit beta ATP4B Potassium-transporting ATPase subunit beta recombinant recombinant-proteins proteins protein

 

CORPORATE
About Us Careers Privacy Notice Events & News Terms & Conditions
SUPPORT
Contact Us Worldwide Distributors Quality Control Technical Support
RESOURCE
Product Catalog Product Citations Signaling Pathways Solution Calculators
FOLLOW OUR
Social Network
Newsletter Subscription
Subscribe to receive our lastest product updates and special offers!
Corporate
Support
Resource
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
TargetMol
Copyright © 2015-2024 TargetMol Chemicals Inc. All rights reserved.