Home Tools
Log in
Cart

ASFV (strain Ba71V) p30 Protein (His)

Catalog No. TMPH-00033
Synonyms: Ba71V-93, Phosphoprotein p30, p30, CP204L, Phosphoprotein p32

Modifies the subcellular distribution of heterogeneous nuclear ribonucleoprotein K (HNRNPK) and may contribute to modulate HNRNPK functions related to processing and export of mRNAs during ASFV infection.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ASFV (strain Ba71V) p30 Protein (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Modifies the subcellular distribution of heterogeneous nuclear ribonucleoprotein K (HNRNPK) and may contribute to modulate HNRNPK functions related to processing and export of mRNAs during ASFV infection.
Species ASFV
Expression System E. coli
Tag N-6xHis
Accession Number P34204
Synonyms Ba71V-93, Phosphoprotein p30, p30, CP204L, Phosphoprotein p32
Amino Acid MDFILNISMKMEVIFKTDLRSSSQVVFHAGSLYNWFSVEIINSGRIVTTAIKTLLSTVKYDIVKSAHIYAGQGYTEHQAQEEWNMILHVLFEEETESSASSESIHEKNDNETNECTSSFETLFEQEPSSEEPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIHGTPLKEEEKEVVRLMVIKLLKKNKLLSHLHLMF
Construction 1-204 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 27.6 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Modifies the subcellular distribution of heterogeneous nuclear ribonucleoprotein K (HNRNPK) and may contribute to modulate HNRNPK functions related to processing and export of mRNAs during ASFV infection.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ASFV (strain Ba71V) p30 Protein (His) Ba71V-93 Phosphoprotein p30 p30 CP204L Phosphoprotein p32 recombinant recombinant-proteins proteins protein

 

TargetMol