Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides. |
Species | Klebsiella pneumoniae |
Expression System | E. coli |
Tag | N-terminal 6xHis-tagged |
Accession Number | B5XTL1 |
Synonyms | Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase, 4-amino-4-deoxy-L-arabinose lipid A transferase, Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase, arnT, Undecaprenyl phosphate-alpha-L-Ara4N transferase |
Amino Acid | RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 429-551 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 17.8 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
arnT Protein, Klebsiella pneumoniae, Recombinant (His) Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase 4-amino-4-deoxy-L-arabinose lipid A transferase Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase arnT Undecaprenyl phosphate-alpha-L-Ara4N transferase recombinant recombinant-proteins proteins protein