Home Tools
Log in
Cart

arnT Protein, Klebsiella pneumoniae, Recombinant (His)

Catalog No. TMPH-02379
Synonyms: Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase, 4-amino-4-deoxy-L-arabinose lipid A transferase, Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase, arnT, Undecaprenyl phosphate-alpha-L-Ara4N transferase

Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
arnT Protein, Klebsiella pneumoniae, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.
Species Klebsiella pneumoniae
Expression System E. coli
Tag N-terminal 6xHis-tagged
Accession Number B5XTL1
Synonyms Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase, 4-amino-4-deoxy-L-arabinose lipid A transferase, Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase, arnT, Undecaprenyl phosphate-alpha-L-Ara4N transferase
Amino Acid RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 429-551 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 17.8 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

arnT Protein, Klebsiella pneumoniae, Recombinant (His) Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase 4-amino-4-deoxy-L-arabinose lipid A transferase Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase arnT Undecaprenyl phosphate-alpha-L-Ara4N transferase recombinant recombinant-proteins proteins protein

 

TargetMol