ALKAL2 Protein, Human, Recombinant (His & Myc)

Name: ALKAL2 Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-00914
Price: 176 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: FAM150B, Augmentor alpha (AUG-alpha), ALKAL2, ALK and LTK ligand 2) Copy Product Info

Synonyms: FAM150B, Augmentor alpha (AUG-alpha), ALKAL2, ALK and LTK ligand 2

Catalog No. TMPH-00914 Copy Product Info

ALKAL2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

Pack Size	Price	USA Stock	Global Stock
5 µg	$176	-	In Stock
10 µg	$293	-	In Stock
20 µg	$491	20 days	20 days
50 µg	$926	20 days	20 days
100 µg	$1,500	20 days	20 days
200 µg	$1,750	20 days	20 days
500 µg	$2,150	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:Greater than 85% as determined by SDS-PAGE.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ALKAL2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	Q6UX46
Amino Acid	GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ
Construction	25-152 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	FAM150B, Augmentor alpha (AUG-alpha), ALKAL2, ALK and LTK ligand 2
Research Background	Ligand for receptor tyrosine kinases LTK and ALK. Stimulation of ALK signaling may be involved in regulation of cell proliferation and transformation.

Chemical Properties

Molecular Weight

18.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.