Home Tools
Log in
Cart

ALKAL2 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-00914
Synonyms: FAM150B, AUG-alpha, Augmentor alpha, ALK and LTK ligand 2

ALKAL2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ALKAL2 Protein, Human, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 491.00
100 μg 20 days $ 1,370.00
500 μg 20 days $ 1,960.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description ALKAL2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species Human
Expression System Baculovirus
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number Q6UX46
Synonyms FAM150B, AUG-alpha, Augmentor alpha, ALK and LTK ligand 2
Amino Acid GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 25-152 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 18.4 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Ligand for receptor tyrosine kinases LTK and ALK. Stimulation of ALK signaling may be involved in regulation of cell proliferation and transformation.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ALKAL2 Protein, Human, Recombinant (His & Myc) FAM150B AUG-alpha Augmentor alpha ALK and LTK ligand 2 recombinant recombinant-proteins proteins protein

 

TargetMol