ALKAL2 Protein, Human, Recombinant (E. coli, His & Myc) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | ALKAL2 Protein, Human, Recombinant (E. coli, His & Myc) is expressed in E. coli. |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Accession Number | Q6UX46 |
Synonyms | Augmentor alpha, FAM150B, AUG-alpha, ALK and LTK ligand 2 |
Amino Acid | GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 25-152 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 21.6 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Ligand for receptor tyrosine kinases LTK and ALK. Stimulation of ALK signaling may be involved in regulation of cell proliferation and transformation. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
ALKAL2 Protein, Human, Recombinant (E. coli, His & Myc) Augmentor alpha FAM150B AUG-alpha ALK and LTK ligand 2 recombinant recombinant-proteins proteins protein