Your shopping cart is currently empty

TP508 TFA is a nonproteolytic thrombin peptide. TP508 TFA activates endothelial NO synthase (eNOS) and stimulates the production of NO in human endothelial cells. It activates endothelial cells and stem cells to revascularize and regenerates tissues.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | TP508 TFA is a nonproteolytic thrombin peptide. TP508 TFA activates endothelial NO synthase (eNOS) and stimulates the production of NO in human endothelial cells. It activates endothelial cells and stem cells to revascularize and regenerates tissues. |
| In vitro | TP508 mitigates the effects of nuclear radiation on human endothelial cells in culture restoring endothelial NO production, tube formation, and accelerating repair of radiation-induced DNA double-strand breaks. TP508 (50 μg/mL; 24 hours; HCAEC) treatment reverses radiation-induced endothelial dysfunction (ED) and loss of NO signaling by attenuating the downregulation of eNOS expression [1]. TP508 acts as an antagonist for the effects of thrombin. TP508 peptide inhibits these thrombin-induced effects through an RGD and αvβ3-related mechanism [3]. |
| In vivo | In male CD-1 mice, the treatment of TP508 (10 mg/kg; i.v.) mitigates radiation-induced endothelial cell damage, also significantly increases survival of CD-1 mice when injected 24 h after 8.5 Gy exposure [1]. |
| Synonyms | TP508 TFA |
| Molecular Weight | 2426.46 |
| Formula | C99H147N28F3O38S |
| Relative Density. | no data available |
| Sequence | H-Ala-Gly-Tyr-Lys-Pro-Asp-Glu-Gly-Lys-Arg-Gly-Asp-Ala-Cys-Glu-Gly-Asp-Ser-Gly-Gly-Pro-Phe-Val-NH2.H-Ala-Gly-Tyr-Lys-Pro-Asp-Glu-Gly-Lys-Arg-Gly-Asp-Ala-Cys-Glu-Gly-Asp-Ser-Gly-Gly-Pro-Phe-Val-NH2.H-Ala-Gly-Tyr-Lys-Pro-Asp-Glu-Gly-Lys-Arg-Gly-Asp-Ala-Cys-Glu-Gly-Asp-Ser-Gly-Gly-Pro-Phe-Val-NH2.2CH3CO2H |
| Sequence Short | AGYKPDEGKRGDACEGDSGGPFVAGYKPDEGKRGDACEGDSGGPFVAGYKPDEGKRGDACEGDSGGPFV |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.