Your shopping cart is currently empty

RVG29-Cys is a peptide derived from rabies virus glycoprotein (RVG) that specifically binds to nicotinic acetylcholine receptors (nAchR) on neural cells. It is employed to functionalize lipid nanoparticles (LNPs) via thiol-maleimide click chemistry for targeting nAchR present on the blood-brain barrier (BBB). mRNA LNPs functionalized with RVG29-Cys demonstrate enhanced transfection efficiency in cultured brain endothelial and neuronal cells, as well as in mice following systemic administration.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | $535 | 35 days | 35 days |
| Description | RVG29-Cys is a peptide derived from rabies virus glycoprotein (RVG) that specifically binds to nicotinic acetylcholine receptors (nAchR) on neural cells. It is employed to functionalize lipid nanoparticles (LNPs) via thiol-maleimide click chemistry for targeting nAchR present on the blood-brain barrier (BBB). mRNA LNPs functionalized with RVG29-Cys demonstrate enhanced transfection efficiency in cultured brain endothelial and neuronal cells, as well as in mice following systemic administration. |
| In vitro | RVG29-Cys is a peptide originating from rabies virus glycoprotein (RVG) that specifically targets nicotinic acetylcholine receptors (nAchR) on neuronal cells. It is utilized to functionalize lipid nanoparticles (LNPs) through thiol-maleimide click chemistry, facilitating nAchR targeting on the blood-brain barrier (BBB). mRNA LNPs enhanced with RVG29-Cys exhibit increased transfection efficiency in both cultured brain endothelial and neuronal cells, as well as in vivo following systemic administration in mice. |
| Cas No. | 1404289-25-3 |
| Sequence | Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-S |
| Sequence Short | YTIWMPENPRPGTPCDIFTNSRGKRASNGC |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.