Shopping Cart
- Remove All
Your shopping cart is currently empty
Prokineticin 2 Isoform 2 (human), a hypothalamic neuropeptide, regulates thermoregulation and energy metabolism while decreasing food intake in rodents. This isoform is implicated in the study of metabolic syndrome (MetS), obesity, and hyperglycemia [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Prokineticin 2 Isoform 2 (human), a hypothalamic neuropeptide, regulates thermoregulation and energy metabolism while decreasing food intake in rodents. This isoform is implicated in the study of metabolic syndrome (MetS), obesity, and hyperglycemia [1]. |
| Molecular Weight | 8802.49 |
| Formula | C379H616N114O101S13 |
| Cas No. | 423206-00-2 |
| Sequence | Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly |
| Sequence Short | AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPF |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.