Your shopping cart is currently empty

Human Prokineticin-2 peptide (28-74, 96-128) is a truncated version of human Prokineticin-2 (PROK2), derived from SEQ NO:6 in Patent WO2002036625A2, and can be used for relevant research in the life sciences field. Prokineticin-2 (human) is a regulatory hypothalamic neuropeptide that plays a role in food intake, thermoregulation, and energy metabolism.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Human Prokineticin-2 peptide (28-74, 96-128) is a truncated version of human Prokineticin-2 (PROK2), derived from SEQ NO:6 in Patent WO2002036625A2, and can be used for relevant research in the life sciences field. Prokineticin-2 (human) is a regulatory hypothalamic neuropeptide that plays a role in food intake, thermoregulation, and energy metabolism. |
| Synonyms | PROK2 human peptide(28-74, 96-128), PK2 human peptide(28-74, 96-128) |
| Molecular Weight | 8802.49 |
| Formula | C379H616N114O101S13 |
| Cas No. | 423206-00-2 |
| Sequence | Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys |
| Sequence Short | AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPF |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.