Your shopping cart is currently empty

Synonyms: (Pro3) GIP, human acetate(299898-52-5 Free base), (Pro3) Gastric Inhibitory Peptide, human acetate
(Pro3) GIP, human acetate
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $108 | - | In Stock | |
| 5 mg | $269 | - | In Stock | |
| 10 mg | $431 | - | In Stock | |
| 25 mg | $733 | - | In Stock | |
| 50 mg | $1,100 | - | In Stock |
| Description | (Pro3) GIP, human acetate (299898-52-5 Free base) is a potent, stable, and specific full agonist peptide for the human GIP receptor (GIPR). (Pro3) GIP, human acetate (299898-52-5 Free base) is the acetate salt form of a modified analog of natural GIP in which three alanine (Ala) residues have been mutated to proline (Pro). (Pro3) GIP, human acetate (299898-52-5 Free base) is a glucose-dependent insulin secretion (GIP) agonist and a weak inhibitor of gastric acid secretion. |
| Synonyms | (Pro3) GIP, human acetate(299898-52-5 Free base), (Pro3) Gastric Inhibitory Peptide, human acetate |
| Sequence | Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Sequence Short | YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.