Shopping Cart
Remove All
Your shopping cart is currently empty
Nagrestipen, a variant of the human macrophage inflammatory protein-1 alpha (MIP-1α), also referred to as ECI 301, exhibits antitumor activity. It is employed in therapeutic trials focused on cancer, assessing its efficacy in the contexts of tumors, metastasis, radiation oncology, and the analysis of tumor metastasis [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Nagrestipen, a variant of the human macrophage inflammatory protein-1 alpha (MIP-1α), also referred to as ECI 301, exhibits antitumor activity. It is employed in therapeutic trials focused on cancer, assessing its efficacy in the contexts of tumors, metastasis, radiation oncology, and the analysis of tumor metastasis [1]. |
| In vivo | Nagrestipen (ECI 301) administered intravenously (i.v.; 2 µg; daily for 5 days) significantly reduces tumor growth at 6 Gy of localized radiation exposure and augments abscopal effects in male BALB/c mice [1]. Additionally, Nagrestipen (ECI 301) demonstrates dose-dependent antitumor efficacy (i.v.; 0.08, 0.4, 2 µg; on days 1, 8, and 15) at both irradiated and non-irradiated sites in female C57BL/6 mice implanted with LLC cells [1]. |
| Cas No. | 166089-33-4 |
| Sequence Short | SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.