Your shopping cart is currently empty

Nagrestipen, a variant of the human macrophage inflammatory protein-1 alpha (MIP-1α), also referred to as ECI 301, exhibits antitumor activity. It is employed in therapeutic trials focused on cancer, assessing its efficacy in the contexts of tumors, metastasis, radiation oncology, and the analysis of tumor metastasis [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Nagrestipen, a variant of the human macrophage inflammatory protein-1 alpha (MIP-1α), also referred to as ECI 301, exhibits antitumor activity. It is employed in therapeutic trials focused on cancer, assessing its efficacy in the contexts of tumors, metastasis, radiation oncology, and the analysis of tumor metastasis [1]. |
| In vivo | Nagrestipen (ECI 301) administered intravenously (i.v.; 2 µg; daily for 5 days) significantly reduces tumor growth at 6 Gy of localized radiation exposure and augments abscopal effects in male BALB/c mice [1]. Additionally, Nagrestipen (ECI 301) demonstrates dose-dependent antitumor efficacy (i.v.; 0.08, 0.4, 2 µg; on days 1, 8, and 15) at both irradiated and non-irradiated sites in female C57BL/6 mice implanted with LLC cells [1]. |
| Cas No. | 166089-33-4 |
| Sequence | Ser-Leu-Ala-Ala-Asp-Thr-Pro-Thr-Ala-Cys-Cys-Phe-Ser-Tyr-Thr-Ser-Arg-Gln-Ile-Pro-Gln-Asn-Phe-Ile-Ala-Ala-Tyr-Phe-Glu-Thr-Ser-Ser-Gln-Cys-Ser-Lys-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Ser-Arg-Gln-Val-Cys-Ala-Asp-Pro-Ser-Glu-Glu-Trp-Val-Gln-Lys-Tyr-Val-Ser-Asp-Leu-Glu-Leu-Ser-Ala-Asp-Ile-Ser-Leu-Phe-Ile-Asp-Glu-Arg-Ile-Asp-Gly-Glu-Cys-Tyr-Ser-Cys-Tyr-Ser-Cys-Tyr-Ser-Cys-Tyr-Ser |
| Sequence Short | SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.