Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms:

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | MciZ is a peptide consisting of 40 amino acids that inhibits the GTPase activity of FtsZ, thereby preventing improper Z-ring formation during the process of sporulation. |
| Molecular Weight | 4774.7 |
| Formula | C222H355N61O52S2 |
| Sequence | Met-Lys-Val-His-Arg-Met-Pro-Lys-Gly-Val-Val-Leu-Val-Gly-Lys-Ala-Trp-Glu-Ile-Arg-Ala-Lys-Leu-Lys-Glu-Tyr-Gly-Arg-Thr-Phe-Gln-Tyr-Val-Lys-Asp-Trp-Ile-Ser-Lys-Pro |
| Sequence Short | MKVHRMPKGVVLVGKAWEIRAKLKEYGRTFQYVKDWISKP |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.