Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Cecropin A TFA (80451-04-3 free base)

Copy Product Info
😃Good
Catalog No. T10750
Alias Cecropin A TFA

Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.

Cecropin A TFA (80451-04-3 free base)

Cecropin A TFA (80451-04-3 free base)

Copy Product Info
😃Good
Catalog No. T10750Alias Cecropin A TFA
Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
1 mg$171InquiryInquiry
5 mg$434InquiryInquiry
10 mg$654InquiryInquiry
50 mgInquiryInquiryInquiry
100 mgInquiryInquiryInquiry
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
TargetMol
View More

Resource Download

Product Introduction

Bioactivity
Description
Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.
In vitro
Cecropin A (10, 20, 30, 40, and 50 μM) induces cytotoxicity on HL-60 cells in a dose-dependent manner [1]. Cecropin A shows good antibacterial activity against both multidrug-resistant Gram-negative bacteria such as A. baumanii and multidrug-resistant P. aeruginosa (IC50s: 0.5-1 μM). Cecropin A (0.1, 0.25 μM) exhibits anti-inflammatory activities. Cecropin A (25 μM) effectively suppresses the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibits the expression of mMIP-1 mRNA. Cecropin A also effectively inhibits LPS-induced phosphorylation of ERK, JNK, p38 MAPK, and reduced the expression of COX-2 [2].
SynonymsCecropin A TFA
Chemical Properties
Molecular Weight4117.8
FormulaC186H314N53O48F3
SmilesFC(F)(F)C(O)=O.[KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2]
Relative Density.no data available
Storage & Solubility Information
StoragePowder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.
Solubility Information
H2O: 50 mg/mL (12.14 mM), Sonication is recommended.
Solution Preparation Table
H2O
1mg5mg10mg50mg
1 mM0.2428 mL1.2142 mL2.4285 mL12.1424 mL
5 mM0.0486 mL0.2428 mL0.4857 mL2.4285 mL
10 mM0.0243 mL0.1214 mL0.2428 mL1.2142 mL

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 μL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Related Tags: buy Cecropin A TFA (80451-04-3 free base) | purchase Cecropin A TFA (80451-04-3 free base) | Cecropin A TFA (80451-04-3 free base) cost | order Cecropin A TFA (80451-04-3 free base) | Cecropin A TFA (80451-04-3 free base) in vitro | Cecropin A TFA (80451-04-3 free base) formula | Cecropin A TFA (80451-04-3 free base) molecular weight