Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Cecropin A TFA
Cecropin A TFA
(80451-04-3 free base)
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $171 | Inquiry | Inquiry | |
| 5 mg | $434 | Inquiry | Inquiry | |
| 10 mg | $654 | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry | |
| 100 mg | Inquiry | Inquiry | Inquiry |
| Description | Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity. |
| In vitro | Cecropin A (10, 20, 30, 40, and 50 μM) induces cytotoxicity on HL-60 cells in a dose-dependent manner [1]. Cecropin A shows good antibacterial activity against both multidrug-resistant Gram-negative bacteria such as A. baumanii and multidrug-resistant P. aeruginosa (IC50s: 0.5-1 μM). Cecropin A (0.1, 0.25 μM) exhibits anti-inflammatory activities. Cecropin A (25 μM) effectively suppresses the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibits the expression of mMIP-1 mRNA. Cecropin A also effectively inhibits LPS-induced phosphorylation of ERK, JNK, p38 MAPK, and reduced the expression of COX-2 [2]. |
| Synonyms | Cecropin A TFA |
| Molecular Weight | 4117.8 |
| Formula | C186H314N53O48F3 |
| Smiles | FC(F)(F)C(O)=O.[KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2] |
| Relative Density. | no data available |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (12.14 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.