Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Cecropin A TFA (80451-04-3 free base)

😃Good
Catalog No. T10750
Alias Cecropin A TFA

Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.

Cecropin A TFA (80451-04-3 free base)

Cecropin A TFA (80451-04-3 free base)

😃Good
Catalog No. T10750Alias Cecropin A TFA
Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
1 mg$171InquiryInquiry
5 mg$434InquiryInquiry
10 mg$654InquiryInquiry
50 mgInquiryInquiryInquiry
100 mgInquiryInquiryInquiry
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
TargetMol
View More

Resource Download

Product Introduction

Bioactivity
Description
Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.
In vitro
Cecropin A (10, 20, 30, 40, and 50 μM) induces cytotoxicity on HL-60 cells in a dose-dependent manner [1]. Cecropin A shows good antibacterial activity against both multidrug-resistant Gram-negative bacteria such as A. baumanii and multidrug-resistant P. aeruginosa (IC50s: 0.5-1 μM). Cecropin A (0.1, 0.25 μM) exhibits anti-inflammatory activities. Cecropin A (25 μM) effectively suppresses the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibits the expression of mMIP-1 mRNA. Cecropin A also effectively inhibits LPS-induced phosphorylation of ERK, JNK, p38 MAPK, and reduced the expression of COX-2 [2].
SynonymsCecropin A TFA
Chemical Properties
Molecular Weight4117.8
FormulaC186H314N53O48F3
SmilesFC(F)(F)C(O)=O.[KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2]
Relative Density.no data available
Storage & Solubility Information
StoragePowder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.
Solubility Information
H2O: 50 mg/mL (12.14 mM), Sonication is recommended.
Solution Preparation Table
H2O
1mg5mg10mg50mg
1 mM0.2428 mL1.2142 mL2.4285 mL12.1424 mL
5 mM0.0486 mL0.2428 mL0.4857 mL2.4285 mL
10 mM0.0243 mL0.1214 mL0.2428 mL1.2142 mL

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experimentsFor example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。
Stock solution preparation method: 2 mg of drug dissolved in 50 μL DMSOTargetMol | reagent (stock solution concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
Preparation method for in vivo formula: Take 50 μL DMSOTargetMol | reagent main solution, add 300 μLPEG300TargetMol | reagent mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2OTargetMol | reagent mix well and clarify
The above example illustrates how to use "In Vivo Formulation Calculator" and does not represent a recommended formulation for any specific compound. Please select an appropriate dissolution method based on your experimental animals and route of administration.
All types of co-solvents required for the protocol, such asDMSO, PEG300/ PEG400, Tween 80, SBE-β-CD, corn oil are available for purchase on the TargetMol website with a simple click.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Related Tags: buy Cecropin A TFA (80451-04-3 free base) | purchase Cecropin A TFA (80451-04-3 free base) | Cecropin A TFA (80451-04-3 free base) cost | order Cecropin A TFA (80451-04-3 free base) | Cecropin A TFA (80451-04-3 free base) in vitro | Cecropin A TFA (80451-04-3 free base) formula | Cecropin A TFA (80451-04-3 free base) molecular weight