Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

Cecropin A TFA (80451-04-3 free base)

Name: Cecropin A TFA (80451-04-3 free base)
Brand: TargetMol
SKU: T10750
Rating: 4.5 (1 reviews)

😃Good

Catalog No. T10750

Alias Cecropin A TFA

Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.

Cecropin A TFA (80451-04-3 free base)

😃Good

Catalog No. T10750Alias Cecropin A TFA

Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.

Pack Size	Price	USA Warehouse	Global Warehouse
1 mg	$171	Inquiry	Inquiry
5 mg	$434	Inquiry	Inquiry
10 mg	$654	Inquiry	Inquiry
50 mg	Inquiry	Inquiry	Inquiry
100 mg	Inquiry	Inquiry	Inquiry

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description	Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.
In vitro	Cecropin A (10, 20, 30, 40, and 50 μM) induces cytotoxicity on HL-60 cells in a dose-dependent manner [1]. Cecropin A shows good antibacterial activity against both multidrug-resistant Gram-negative bacteria such as A. baumanii and multidrug-resistant P. aeruginosa (IC50s: 0.5-1 μM). Cecropin A (0.1, 0.25 μM) exhibits anti-inflammatory activities. Cecropin A (25 μM) effectively suppresses the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibits the expression of mMIP-1 mRNA. Cecropin A also effectively inhibits LPS-induced phosphorylation of ERK, JNK, p38 MAPK, and reduced the expression of COX-2 [2].
Synonyms	Cecropin A TFA

Chemical Properties

Molecular Weight	4117.8
Formula	C₁₈₆H₃₁₄N₅₃O₄₈F₃
Smiles	FC(F)(F)C(O)=O.[KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2]
Relative Density.	no data available

Storage & Solubility Information

Storage

Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 50 mg/mL (12.14 mM), Sonication is recommended.

Solution Preparation Table

H2O

	1mg	5mg	10mg	50mg
1 mM	0.2428 mL	1.2142 mL	2.4285 mL	12.1424 mL
5 mM	0.0486 mL	0.2428 mL	0.4857 mL	2.4285 mL
10 mM	0.0243 mL	0.1214 mL	0.2428 mL	1.2142 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Cecropin A TFA (80451043 free base)Cecropin A TFA (80451 04 3 free base)80451-04-3 free base80451-04-3

Related Tags: buy Cecropin A TFA (80451-04-3 free base) | purchase Cecropin A TFA (80451-04-3 free base) | Cecropin A TFA (80451-04-3 free base) cost | order Cecropin A TFA (80451-04-3 free base) | Cecropin A TFA (80451-04-3 free base) in vitro | Cecropin A TFA (80451-04-3 free base) formula | Cecropin A TFA (80451-04-3 free base) molecular weight