Shopping Cart
Remove All
Your shopping cart is currently empty
Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $171 | Inquiry | Inquiry | |
| 5 mg | $434 | Inquiry | Inquiry | |
| 10 mg | $654 | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry | |
| 100 mg | Inquiry | Inquiry | Inquiry |
| Description | Cecropin A TFA is an antimicrobial polypeptide isolated from Hyalaphora cecropia pupae with anti-inflammatory, anti-bacterial, and anti-cancer activity. |
| In vitro | Cecropin A (10, 20, 30, 40, and 50 μM) induces cytotoxicity on HL-60 cells in a dose-dependent manner [1]. Cecropin A shows good antibacterial activity against both multidrug-resistant Gram-negative bacteria such as A. baumanii and multidrug-resistant P. aeruginosa (IC50s: 0.5-1 μM). Cecropin A (0.1, 0.25 μM) exhibits anti-inflammatory activities. Cecropin A (25 μM) effectively suppresses the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibits the expression of mMIP-1 mRNA. Cecropin A also effectively inhibits LPS-induced phosphorylation of ERK, JNK, p38 MAPK, and reduced the expression of COX-2 [2]. |
| Synonyms | Cecropin A TFA |
| Molecular Weight | 4117.8 |
| Formula | C186H314N53O48F3 |
| Smiles | FC(F)(F)C(O)=O.[KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2] |
| Relative Density. | no data available |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (12.14 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.