ZNRF3 Protein, Human, Recombinant (His)

Name: ZNRF3 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01275
Rating: 4.5 (1 reviews)

(Synonyms: ZNRF3, Zinc/RING finger protein 3, RNF203, RING-type E3 ubiquitin transferase ZNRF3, RING finger protein 203, KIAA1133, E3 ubiquitin-protein ligase ZNRF3) Copy Product Info

Synonyms: ZNRF3, Zinc/RING finger protein 3, RNF203, RING-type E3 ubiquitin transferase ZNRF3, RING finger protein 203, KIAA1133, E3 ubiquitin-protein ligase ZNRF3

Catalog No. TMPH-01275 Copy Product Info

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.

Pack Size	Price	USA Stock	Global Stock
5 µg	$67	20 days	20 days
10 µg	$107	20 days	20 days
20 µg	$175	20 days	20 days
50 µg	$268	20 days	20 days
100 µg	$377	20 days	20 days
200 µg	$688	20 days	20 days
500 µg	$1,530	20 days	20 days
1 mg	$2,860	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/mL can bind Human RSPO2, the EC 50 is 5.091-6.991 ng/mL.
Description	E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.
Species	Human
Expression System	HEK293 Cells
Tag	C-6xHis
Accession Number	Q9ULT6
Amino Acid	KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Construction	56-219 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	ZNRF3, Zinc/RING finger protein 3, RNF203, RING-type E3 ubiquitin transferase ZNRF3, RING finger protein 203, KIAA1133, E3 ubiquitin-protein ligase ZNRF3
Research Background	E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.

Chemical Properties

Molecular Weight

20.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.