Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Zaire ebolavirus (strain Mayinga-76) L Protein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03734 Copy Product Info
Zaire ebolavirus (strain Mayinga-76) L Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.9 kDa and the accession number is Q05318.

Zaire ebolavirus (strain Mayinga-76) L Protein (His)

Catalog No. TMPH-03734
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Zaire ebolavirus (strain Mayinga-76) L Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.9 kDa and the accession number is Q05318.

Zaire ebolavirus (strain Mayinga-76) L Protein (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Zaire ebolavirus (strain Mayinga-76) L Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.9 kDa and the accession number is Q05318.
Species
ZEBOV
Expression System
E. coli
TagN-6xHis
Accession NumberQ05318
Synonyms
Transcriptase,RNA-directed RNA polymerase L,Replicase,Protein L,Large structural protein
Amino Acid
RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG
Construction
625-809 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight24.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.; RNA-directed RNA polymerase that catalyzes the replication of viral genomic RNA. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing transcriptional signals, and the replicated genome is not caped or polyadenylated.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords