Shopping Cart
- Remove All
- Your shopping cart is currently empty
Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. YTFE Protein, E. coli, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 51.9 kDa and the accession number is P69506.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $237 | 20 days | |
100 μg | $490 | 20 days | |
1 mg | $2,080 | 20 days |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/mL can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 μg/mL. |
Description | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. YTFE Protein, E. coli, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 51.9 kDa and the accession number is P69506. |
Species | E. coli |
Expression System | E. coli |
Tag | N-GST |
Accession Number | P69506 |
Synonyms | ytfE,Regulator of cell morphogenesis and NO signaling (RCMNS),Iron-sulfur cluster repair protein YtfE |
Amino Acid | MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE |
Construction | 1-220 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 51.9 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.