Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: ytfE, Regulator of cell morphogenesis and NO signaling (RCMNS), Iron-sulfur cluster repair protein YtfE


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $89 | 20 days | 20 days | |
| 10 µg | $143 | 20 days | 20 days | |
| 20 µg | $237 | 20 days | 20 days | |
| 50 µg | $358 | 20 days | 20 days | |
| 100 µg | $490 | 20 days | 20 days | |
| 200 µg | $755 | 20 days | 20 days | |
| 500 µg | $1,330 | 20 days | 20 days | |
| 1 mg | $2,080 | 20 days | 20 days |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/mL can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 μg/mL. |
| Description | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. YTFE Protein, E. coli, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 51.9 kDa and the accession number is P69506. |
| Species | E. coli |
| Expression System | E. coli |
| Tag | N-GST |
| Accession Number | P69506 |
| Amino Acid | MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE |
| Construction | 1-220 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | ytfE, Regulator of cell morphogenesis and NO signaling (RCMNS), Iron-sulfur cluster repair protein YtfE |
| Research Background | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. |
| Molecular Weight | 51.9 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.