Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

YAP1 Protein, Human, Recombinant (Isoform 9, His)

Catalog No. TMPH-00005

YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.

YAP1 Protein, Human, Recombinant (Isoform 9, His)

YAP1 Protein, Human, Recombinant (Isoform 9, His)

Catalog No. TMPH-00005
YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.
Pack SizePriceAvailabilityQuantity
20 μg$231In Stock
100 μg$480Inquiry
500 μg$1,330Inquiry
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.
Species
Human
Expression System
P. pastoris (Yeast)
TagC-6xHis
Accession NumberP46937-9
Synonyms
Yes-associated protein YAP65 homolog,YAP1-2delta,YAP1,Transcriptional coactivator YAP1,Protein yorkie homolog
Amino Acid
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Construction
1-508 aa
Protein Purity
> 85% as determined by SDS-PAGE.
YAP1 Protein, Human, Recombinant (Isoform 9, His)
Molecular Weight56.4 kDa (predicted); 80 kDa (reducing conditions)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords