Shopping Cart
Remove All
Your shopping cart is currently empty
YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $86 | Inquiry | Inquiry | |
| 10 μg | $138 | Inquiry | Inquiry | |
| 20 μg | $231 | - | In Stock | |
| 50 μg | $348 | Inquiry | Inquiry | |
| 100 μg | $480 | Inquiry | Inquiry | |
| 200 μg | $743 | Inquiry | Inquiry | |
| 500 μg | $1,330 | Inquiry | Inquiry |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis |
| Accession Number | P46937-9 |
| Synonyms | Yes-associated protein YAP65 homolog,YAP1-2delta,YAP1,Transcriptional coactivator YAP1,Protein yorkie homolog |
| Amino Acid | MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Construction | 1-508 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 56.4 kDa (predicted); 80 kDa (reducing conditions) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0. |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.