YAP1 Protein, Human, Recombinant (Isoform 9, His)

Name: YAP1 Protein, Human, Recombinant (Isoform 9, His)
Brand: TargetMol
SKU: TMPH-00005
Rating: 4.5 (1 reviews)

(Synonyms: Yes-associated protein YAP65 homolog, YAP1-2delta, YAP1, Transcriptional coactivator YAP1, Protein yorkie homolog) Copy Product Info

Synonyms: Yes-associated protein YAP65 homolog, YAP1-2delta, YAP1, Transcriptional coactivator YAP1, Protein yorkie homolog

Catalog No. TMPH-00005 Copy Product Info

YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$86	Inquiry	Inquiry
10 µg	$138	Inquiry	Inquiry
20 µg	$231	-	In Stock
50 µg	$348	Inquiry	Inquiry
100 µg	$480	Inquiry	Inquiry
200 µg	$743	Inquiry	Inquiry
500 µg	$1,330	Inquiry	Inquiry

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:96%（SDS-PAGE）

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	P46937-9
Amino Acid	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Construction	1-508 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Synonyms	Yes-associated protein YAP65 homolog, YAP1-2delta, YAP1, Transcriptional coactivator YAP1, Protein yorkie homolog

Chemical Properties

Molecular Weight

56.4 kDa (predicted); 80 kDa (reducing conditions)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Related Tags: YAP1 Protein, Human, Recombinant (Isoform 9, His) chemical structure | YAP1 Protein, Human, Recombinant (Isoform 9, His) molecular weight