YAP1 Protein, Human, Recombinant (Isoform 9, His)

Catalog No. TMPH-00005

YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.

YAP1 Protein, Human, Recombinant (Isoform 9, His)

Catalog No. TMPH-00005

YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.

Pack Size	Price	Availability
5 μg	$86	Inquiry
10 μg	$138	Inquiry
20 μg	$231	In Stock
50 μg	$348	Inquiry
100 μg	$480	Inquiry
200 μg	$743	Inquiry
500 μg	$1,330	Inquiry

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	P46937-9
Synonyms	Yes-associated protein YAP65 homolog,YAP1-2delta,YAP1,Transcriptional coactivator YAP1,Protein yorkie homolog
Amino Acid	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Construction	1-508 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	56.4 kDa (predicted); 80 kDa (reducing conditions)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.