Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

YAP1 Protein, Human, Recombinant (E. coli, His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04365 Copy Product Info
YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.

YAP1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-04365
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.

YAP1 Protein, Human, Recombinant (E. coli, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$85InquiryInquiry
10 μg$138InquiryInquiry
20 μg$228InquiryInquiry
50 μg$326InquiryInquiry
100 μg$429InquiryInquiry
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.
Species
Human
Expression System
E. coli
TagC-10xHis
Accession NumberP46937
Synonyms
Yes-associated protein 1,YAP65,YAP 1,Transcriptional coactivator YAP1
Amino Acid
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Construction
1-504 aa
Protein Purity
> 90% as determined by SDS-PAGE.
YAP1 Protein, Human, Recombinant (E. coli, His)
Molecular Weight64.2 kDa
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords