Shopping Cart

Your shopping cart is currently empty

YAP1 Protein, Human, Recombinant (E. coli, His)

Name: YAP1 Protein, Human, Recombinant (E. coli, His)
Brand: TargetMol
SKU: TMPH-04365
Rating: 4.5 (1 reviews)

(Synonyms: Yes-associated protein 1, YAP65, YAP 1, Transcriptional coactivator YAP1) Copy Product Info

Synonyms: Yes-associated protein 1, YAP65, YAP 1, Transcriptional coactivator YAP1

Catalog No. TMPH-04365 Copy Product Info

Purity: 95%

YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$85	Inquiry	Inquiry
10 μg	$138	Inquiry	Inquiry
20 μg	$228	Inquiry	Inquiry
50 μg	$326	Inquiry	Inquiry
100 μg	$429	Inquiry	Inquiry

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:95%

Appearance:Solid

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.
Species	Human
Expression System	E. coli
Tag	C-10xHis
Accession Number	P46937
Amino Acid	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Construction	1-504 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Yes-associated protein 1, YAP65, YAP 1, Transcriptional coactivator YAP1

Chemical Properties

Molecular Weight	64.2 kDa
Relative Density.	no data available

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

YAP1Protein,Human,Recombinant(E.coli,His)YAP 65

Related Tags: YAP1 Protein, Human, Recombinant (E. coli, His) chemical structure | YAP1 Protein, Human, Recombinant (E. coli, His) molecular weight