YAP1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-04365

YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.

YAP1 Protein, Human, Recombinant (E. coli, His)

Catalog No. TMPH-04365

YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$85	Backorder	Backorder
10 μg	$138	Backorder	Backorder
20 μg	$228	Backorder	Backorder
50 μg	$326	Backorder	Backorder
100 μg	$429	Backorder	Backorder

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	YAP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli. The accession number is P46937.
Species	Human
Expression System	E. coli
Tag	C-10xHis
Accession Number	P46937
Synonyms	Yes-associated protein 1,YAP65,YAP 1,Transcriptional coactivator YAP1
Amino Acid	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Construction	1-504 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	64.2 kDa
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.