Shopping Cart
Remove All
Your shopping cart is currently empty
VSIV (strain Glasgow) Matrix Protein (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 30.7 kDa and the accession number is P04876.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $176 | 20 days | 20 days | |
| 10 μg | $292 | 20 days | 20 days | |
| 20 μg | $489 | 20 days | 20 days | |
| 50 μg | $923 | 20 days | 20 days | |
| 100 μg | $1,500 | 20 days | 20 days | |
| 200 μg | $1,890 | 20 days | 20 days | |
| 500 μg | $2,580 | 20 days | 20 days | |
| 1 mg | $3,260 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | VSIV (strain Glasgow) Matrix Protein (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 30.7 kDa and the accession number is P04876. |
| Species | VSIV |
| Expression System | Baculovirus Insect Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | P04876 |
| Synonyms | Matrix protein,M protein |
| Amino Acid | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF |
| Construction | 1-237 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 30.7 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Plays a major role in assembly and budding of virion, by recruiting cellular partners of the ESCRT complexes that play a key role in releasing the budding particle from the host membrane. Condensates the ribonucleocapsid core during virus assembly.; Inhibits mRNA nuclear export through direct interaction with host RAE1-NUP98 complex, thereby preventing interferon signaling and establishment of antiviral state in infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell. Inhibits host transcription, possibly through interaction with host DNA repair factor IIH/TFIIH GTF2H5 subunit. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.