Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

VSIV (strain 94GUB Central America) L Protein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03699 Copy Product Info
VSIV (strain 94GUB Central America) L Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is Q8B0H0.

VSIV (strain 94GUB Central America) L Protein (His)

Catalog No. TMPH-03699
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

VSIV (strain 94GUB Central America) L Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is Q8B0H0.

VSIV (strain 94GUB Central America) L Protein (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
VSIV (strain 94GUB Central America) L Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is Q8B0H0.
Species
VSIV
Expression System
E. coli
TagN-6xHis
Accession NumberQ8B0H0
Synonyms
Transcriptase,RNA-directed RNA polymerase L,Replicase,Protein L,Large structural protein
Amino Acid
ICIANHIDYEKWNNHQRKLSNGPVFRVMGQFLGYPSLIERTHEFFEKSLIYYNGRPDLMRVHNNTLVNSTSQRVCWQGQEGGLEGLRQKGWSILNLLVIQREAKIRNTAVKVLAQGDNQVICTQYKTKKSRNVVELQSALNQMVSNNEKIMTAIKIGTGKLGLLINDDETMQSADYLNYGKIPIFRG
Construction
598-784 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight25.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Responsible for RNA synthesis (replicase and transcriptase), cap addition, and cap methylation. Performs also the polyadenylation of subgenomic mRNAs by a stuttering mechanism at a slipery stop site present at the end of viral genes. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, thereby initiating either genome replication or mRNA transcription. In the transcription mode, the polymerase performs the sequential transcription of all mRNAs using a termination-reinitiation mechanism responding to gene start and gene end signals. Some polymerase disengage from the template at each gene junction, resulting in a decreasing abundance of transcripts from the 3' to the 5' end of the genome. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein helps the polymerase to engage the N-RNA template and acts as processivity factor. Polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. In the replication mode, the polymerase replicates the whole viral genome without recognizing the gene end transcriptional signals. The ability of the polymerase to override the gene end signals as it is producing the antigenome is probably due to replicative RNA becoming encapsidated with nucleoprotein as it is synthesized.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords