Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Vitronectin Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04193

Vitronectin Protein, Human, Recombinant is expressed in HEK293 Cells with Tag free. The accession number is P04004.

Vitronectin Protein, Human, Recombinant

Vitronectin Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04193
Vitronectin Protein, Human, Recombinant is expressed in HEK293 Cells with Tag free. The accession number is P04004.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$5220 days20 days
10 μg$8220 days20 days
20 μg$15320 days20 days
50 μg$36220 days20 days
100 μg$39220 days20 days
200 μg$44220 days20 days
500 μg$49320 days20 days
1 mg$55820 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.
Description
Vitronectin Protein, Human, Recombinant is expressed in HEK293 Cells with Tag free. The accession number is P04004.
Species
Human
Expression System
HEK293 Cells
TagTag free
Accession NumberP04004
Synonyms
VTN,VN,Vitronectin,V75,S-protein,Serum-spreading factor
Amino Acid
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Construction
20-478 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight52.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords