Shopping Cart
Remove All
Your shopping cart is currently empty
Vitronectin Protein, Human, Recombinant is expressed in HEK293 Cells with Tag free. The accession number is P04004.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $52 | 20 days | 20 days | |
| 10 μg | $82 | 20 days | 20 days | |
| 20 μg | $153 | 20 days | 20 days | |
| 50 μg | $362 | 20 days | 20 days | |
| 100 μg | $392 | 20 days | 20 days | |
| 200 μg | $442 | 20 days | 20 days | |
| 500 μg | $493 | 20 days | 20 days | |
| 1 mg | $558 | 20 days | 20 days |
| Biological Activity | Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL.
Optimal concentration depends on cell type as well as the application or research objectives. |
| Description | Vitronectin Protein, Human, Recombinant is expressed in HEK293 Cells with Tag free. The accession number is P04004. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | Tag free |
| Accession Number | P04004 |
| Synonyms | VTN,VN,Vitronectin,V75,S-protein,Serum-spreading factor |
| Amino Acid | DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL |
| Construction | 20-478 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 52.3 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.