Home Tools
Log in
Cart

Vitellogenin Protein, Apis mellifera, Recombinant (His)

Catalog No. TMPH-00068

Precursor of the egg-yolk proteins that are sources of nutrients during embryonic development. Involved in the differentiation of honeybee larvae into queens. Vitellogenin Protein, Apis mellifera, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 32.5 kDa and the accession number is Q868N5.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Vitellogenin Protein, Apis mellifera, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Precursor of the egg-yolk proteins that are sources of nutrients during embryonic development. Involved in the differentiation of honeybee larvae into queens. Vitellogenin Protein, Apis mellifera, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 32.5 kDa and the accession number is Q868N5.
Species Apis mellifera
Expression System E. coli
Tag N-6xHis
Accession Number Q868N5
Amino Acid EDETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRENEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMGDRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKPEHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDT
Construction 1439-1672 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 32.5 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Precursor of the egg-yolk proteins that are sources of nutrients during embryonic development. Involved in the differentiation of honeybee larvae into queens.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol