Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

VEGFA Protein, Rabbit, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03217

VEGFA Protein, Rabbit, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is XP_002714743.1.

VEGFA Protein, Rabbit, Recombinant (His)

VEGFA Protein, Rabbit, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03217
VEGFA Protein, Rabbit, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is XP_002714743.1.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
200 μg$1,23020 days20 days
500 μg$1,98020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
VEGFA Protein, Rabbit, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is XP_002714743.1.
Species
Rabbit
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberXP_002714743.1
Amino Acid
YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR
Construction
51-511 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight51.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.