Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

VEGFA Protein, Pig, Recombinant (His)

Catalog No. TMPH-03131

VEGFA Protein, Pig, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.2 kDa and the accession number is P49151.

VEGFA Protein, Pig, Recombinant (His)

VEGFA Protein, Pig, Recombinant (His)

Catalog No. TMPH-03131
VEGFA Protein, Pig, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.2 kDa and the accession number is P49151.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
VEGFA Protein, Pig, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.2 kDa and the accession number is P49151.
Species
Sus scrofa (Pig)
Expression System
E. coli
TagN-6xHis
Accession NumberP49151
Synonyms
VEGF-A,VEGFA,VEGF,Vascular permeability factor (VPF),Vascular endothelial growth factor A
Amino Acid
APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Construction
27-190 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight23.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords