Home Tools
Log in
Cart

Variola virus (isolate Human/India/Ind3/1967) Pro-VGF Protein (His & Myc)

Catalog No. TMPH-03689

Variola virus (isolate Human/India/Ind3/1967) Pro-VGF Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 16.6 kDa and the accession number is P0DOP9.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Variola virus (isolate Human/India/Ind3/1967) Pro-VGF Protein (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Variola virus (isolate Human/India/Ind3/1967) Pro-VGF Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 16.6 kDa and the accession number is P0DOP9.
Species VARV
Expression System E. coli
Tag N-10xHis, C-Myc
Accession Number P0DOP9
Amino Acid ANSGNAIETTLSEITNTTTDIPAIRLCGPEGDRYCFHGICIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSEKPNTTTSY
Construction 19-100 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 16.6 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Variola growth factor stimulates cellular proliferation (hyperplasia) around infected cells. This effect is beneficial for virus replication in vivo, because poxviruses replicate possibly better in proliferating cells than in quiescent cells. Acts by binding host EGFR, inducing its dimerization, autophosphorylation and leading to activation of several cellular pathways regulating cell proliferation or cell survival. The activation by host EGFR of mitogen activated protein kinases (MAPK) and extracellular-signal regulated kinases (ERK) are essential for the positive effect of vaccinia growth factor on poxvirus virulence in vivo.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol