Shopping Cart
Remove All
Your shopping cart is currently empty
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 16.5 kDa and the accession number is P33816.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $167 | 20 days | 20 days | |
| 10 μg | $278 | 20 days | 20 days | |
| 20 μg | $465 | 20 days | 20 days | |
| 50 μg | $878 | 20 days | 20 days | |
| 100 μg | $1,430 | 20 days | 20 days | |
| 200 μg | $2,290 | 20 days | 20 days | |
| 500 μg | $4,300 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 16.5 kDa and the accession number is P33816. |
| Species | VARV |
| Expression System | HEK293 Cells |
| Tag | N-6xHis |
| Accession Number | P33816 |
| Synonyms | Protein OPG154,OPG154 |
| Amino Acid | MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
| Construction | 1-110 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 16.5 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.