Home Tools
Log in
Cart

Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His)

Catalog No. TMPH-03686

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 16.5 kDa and the accession number is P33816.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 465.00
100 μg 20 days $ 1,300.00
500 μg 20 days $ 3,910.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 16.5 kDa and the accession number is P33816.
Species VARV
Expression System HEK293 Cells
Tag N-6xHis
Accession Number P33816
Amino Acid MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Construction 1-110 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 16.5 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol