Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Vaccinia virus (strain Copenhagen) OPG193 Protein (hFc)

TargetMol | SPR
Catalog No. TMPH-04369 Copy Product Info
Vaccinia virus (strain Copenhagen) OPG193 Protein (hFc) is expressed in Mammalian cell. The accession number is P21004.

Vaccinia virus (strain Copenhagen) OPG193 Protein (hFc)

Catalog No. TMPH-04369
Copy Product Info
TargetMol | SPR

Vaccinia virus (strain Copenhagen) OPG193 Protein (hFc) is expressed in Mammalian cell. The accession number is P21004.

Vaccinia virus (strain Copenhagen) OPG193 Protein (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$18620 days20 days
10 μg$29720 days20 days
20 μg$51920 days20 days
50 μg$92820 days20 days
100 μg$1,45020 days20 days
200 μg$2,19020 days20 days
500 μg$3,89020 days20 days
1 mg$5,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Vaccinia virus (strain Copenhagen) OPG193 Protein (hFc) is expressed in Mammalian cell. The accession number is P21004.
Species
Vaccinia virus (strain Copenhagen)
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP21004
Synonyms
Soluble interferon gamma receptor OPG193,OPG193,B8
Amino Acid
SIHAKITSYKFESVNFDSKIEWTGDGLYNISLKNYGIKTWQTMYTNVPEGTYDISAFPKNDFVSFWVKFEQGDYKVEEYCTGLCVEVKIGPPTVTLTEYDDHINLYIEHPYATRGSKKIPIYKRGDMCDIYLLYTANFTFGDSEEPVTYDIDDYDCTSTGCSIDFATTEKVCVTAQGATEGFLEKITPWSSEVCLTPKKNVYTCAIRSKEDVPNFKDKMARVIKRKFNKQSQSYLTKFLGSTSNDVTTFLSMLNLTKYS
Construction
14-272 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight58.5 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 6 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords