Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

UL16 Protein, Human, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04671

UL16 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P16757.

UL16 Protein, Human, Recombinant (hFc)

UL16 Protein, Human, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04671
UL16 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P16757.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$72620 days20 days
100 μg$1,15020 days20 days
200 μg$1,77020 days20 days
500 μg$3,13020 days20 days
1 mg$4,83020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
UL16 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P16757.
Species
Human cytomegalovirus (strain AD169)
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP16757
Synonyms
UL16,Protein UL16
Amino Acid
VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGSLYPRPPGSGLAKHPSVSADEELSA
Construction
27-184 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight46.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 308 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords