UL16 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04671

UL16 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P16757.

UL16 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04671

UL16 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P16757.

Pack Size	Price	Availability
5 μg	$143	20 days
10 μg	$238	20 days
20 μg	$397	20 days
50 μg	$726	20 days
100 μg	$1,150	20 days
200 μg	$1,770	20 days
500 μg	$3,130	20 days
1 mg	$4,830	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	UL16 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P16757.
Species	Human cytomegalovirus (strain AD169)
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	P16757
Synonyms	UL16,Protein UL16
Amino Acid	VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGSLYPRPPGSGLAKHPSVSADEELSA
Construction	27-184 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	46.6 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 308 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.