Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Type III secretion system needle Protein, Burkholderia thailandensis, Recombinant (His)

Type III secretion system needle Protein, Burkholderia thailandensis, Recombinant (His)
Resource Download

Type III secretion system needle Protein, Burkholderia thailandensis, Recombinant (His)

Catalog No. TMPH-00319
Type III secretion system needle Protein, Burkholderia thailandensis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.9 kDa and the accession number is Q2T727.
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$76920 days
500 μg$1,78020 days
Bulk & Custom
Add to Cart
Questions
View More

Biological Description

Biological Information
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Type III secretion system needle Protein, Burkholderia thailandensis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.9 kDa and the accession number is Q2T727.
Species
Burkholderia thailandensis
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ2T727
Synonyms
yscF
Amino Acid
MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR
Construction
1-89 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight11.9 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.