Shopping Cart
- Remove All
- Your shopping cart is currently empty
May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $67 | 20 days | |
10 μg | $107 | 20 days | |
20 μg | $175 | 20 days | |
50 μg | $268 | 20 days | |
100 μg | $377 | 20 days | |
200 μg | $688 | 20 days | |
500 μg | $1,530 | 20 days | |
1 mg | $2,860 | 20 days |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody, the EC50 is 2.129-2.956 ng/mL. |
Description | May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation. |
Species | Human |
Expression System | HEK293 Cells |
Tag | C-10xHis |
Accession Number | Q9UIK5 |
Synonyms | Transmembrane protein with EGF-like and two follistatin-like domains,TR-2,TPEF,Tomoregulin-2,TMEFF2,TENB2,Hyperplastic polyposis protein 1,HPP1 |
Amino Acid | FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV |
Construction | 41-320 aa |
Protein Purity | > 95% as determined by SDS-PAGE. |
Molecular Weight | 32.3 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.