TFF3 Protein, Human, Recombinant (GST)

Name: TFF3 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-02243
Rating: 4.5 (1 reviews)

(Synonyms: Trefoil factor 3, TFI, TFF3, Polypeptide P1.B (hP1.B), ITF, Intestinal trefoil factor (hITF)) Copy Product Info

Synonyms: Trefoil factor 3, TFI, TFF3, Polypeptide P1.B (hP1.B), ITF, Intestinal trefoil factor (hITF)

Catalog No. TMPH-02243 Copy Product Info

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Pack Size	Price	USA Stock	Global Stock
5 µg	$89	20 days	20 days
10 µg	$143	20 days	20 days
20 µg	$237	20 days	20 days
50 µg	$358	20 days	20 days
100 µg	$490	20 days	20 days
200 µg	$755	20 days	20 days
500 µg	$1,330	20 days	20 days
1 mg	$2,080	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	Q07654
Amino Acid	ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Construction	29-80 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Trefoil factor 3, TFI, TFF3, Polypeptide P1.B (hP1.B), ITF, Intestinal trefoil factor (hITF)
Research Background	Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Chemical Properties

Molecular Weight

33.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.