Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (His)

Catalog No. TMPH-02193

May be involved in cell proliferation and cell motility. Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.5 kDa and the accession number is P41732.

Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (His)

Catalog No. TMPH-02193

Pack Size	Price	Availability
5 μg	$86	20 days
10 μg	$138	20 days
20 μg	$231	20 days
50 μg	$348	20 days
100 μg	$480	20 days
200 μg	$743	20 days
500 μg	$1,330	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	May be involved in cell proliferation and cell motility. Tetraspanin-7/TSPAN7 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.5 kDa and the accession number is P41732.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P41732
Synonyms	Tspan-7,TSPAN7,Transmembrane 4 superfamily member 2,TM4SF2,Tetraspanin-7,T-cell acute lymphoblastic leukemia-associated antigen 1 (TALLA-1),MXS1,Membrane component chromosome X surface marker 1,DXS1692E,Cell surface glycoprotein A15,CD231,A15
Amino Acid	RHEIKDTFLRTYTDTMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Construction	113-213 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	14.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	May be involved in cell proliferation and cell motility.