Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

TARC/CCL17 Protein, Canine, Recombinant (MBP & His & Avi), Biotinylated

Catalog No. TMPH-04746

TARC/CCL17 Protein, Canine, Recombinant (MBP & His & Avi), Biotinylated is expressed in E. coli. The accession number is Q95N01.

TARC/CCL17 Protein, Canine, Recombinant (MBP & His & Avi), Biotinylated

TARC/CCL17 Protein, Canine, Recombinant (MBP & His & Avi), Biotinylated

Catalog No. TMPH-04746
TARC/CCL17 Protein, Canine, Recombinant (MBP & His & Avi), Biotinylated is expressed in E. coli. The accession number is Q95N01.
Pack SizePriceAvailabilityQuantity
20 μg$57520 days
100 μg$92820 days
1 mg$2,73020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
TARC/CCL17 Protein, Canine, Recombinant (MBP & His & Avi), Biotinylated is expressed in E. coli. The accession number is Q95N01.
Species
Canine
Expression System
E. coli
TagN-MBP, C-6xHis-Avi
Accession NumberQ95N01
Synonyms
Thymus and activation-regulated chemokine,TARC,Small-inducible cytokine A17,CCL17,C-C motif chemokine 17,CC chemokine TARC
Amino Acid
ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES
Construction
24-99 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight56.4 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 383 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords