Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Talin-1 Protein, Human, Recombinant (GST)

Catalog No. TMPH-02176

Probably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts. Talin-1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with GST tag. The predicted molecular weight is 62.8?kDa and the accession number is Q9Y490.

Talin-1 Protein, Human, Recombinant (GST)

Talin-1 Protein, Human, Recombinant (GST)

Catalog No. TMPH-02176
Probably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts. Talin-1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with GST tag. The predicted molecular weight is 62.8?kDa and the accession number is Q9Y490.
Pack SizePriceAvailabilityQuantity
20 μg$19820 days
100 μg$42720 days
1 mg$1,83020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Probably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts. Talin-1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with GST tag. The predicted molecular weight is 62.8?kDa and the accession number is Q9Y490.
Species
Human
Expression System
E. coli
TagN-GST
Accession NumberQ9Y490
Synonyms
TLN1,TLN,Talin-1,KIAA1027
Amino Acid
MLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII
Construction
92-399 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight62.8?kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Probably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords