Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SULT1B1 Protein, Rat, Recombinant (His & Myc & SUMO)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03377 Copy Product Info
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine (T3) and reverse triiodothyronine (rT3). SULT1B1 Protein, Rat, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 54.8 kDa and the accession number is P52847.

SULT1B1 Protein, Rat, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-03377
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine (T3) and reverse triiodothyronine (rT3). SULT1B1 Protein, Rat, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 54.8 kDa and the accession number is P52847.

SULT1B1 Protein, Rat, Recombinant (His & Myc & SUMO)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$8920 days20 days
10 μg$14320 days20 days
20 μg$23720 days20 days
50 μg$35820 days20 days
100 μg$49020 days20 days
200 μg$75520 days20 days
500 μg$1,33020 days20 days
1 mg$2,08020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine (T3) and reverse triiodothyronine (rT3). SULT1B1 Protein, Rat, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 54.8 kDa and the accession number is P52847.
Species
Rat
Expression System
E. coli
TagN-10xHis-SUMO, C-Myc
Accession NumberP52847
Synonyms
Sult1b1,Sulfotransferase family cytosolic 1B member 1,Sulfotransferase 1B1,St1b1,DOPA/tyrosine sulfotransferase
Amino Acid
MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA
Construction
1-299 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight54.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine (T3) and reverse triiodothyronine (rT3).

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords