Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00173 Copy Product Info
Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 18.8 kDa and the accession number is O07623.

Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI)

Catalog No. TMPH-00173
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 18.8 kDa and the accession number is O07623.

Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$129-In Stock
10 μg$216-In Stock
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$745-In Stock
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 18.8 kDa and the accession number is O07623.
Species
Bacillus subtilis
Expression System
E. coli
TagN-6xHis-KSI
Accession NumberO07623
Synonyms
Subtilosin-A,sboA,sbo,Antilisterial bacteriocin subtilosin
Amino Acid
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
Construction
9-43 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI)
Molecular Weight18.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.