Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI)

Catalog No. TMPH-00173 Copy Product Info

Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 18.8 kDa and the accession number is O07623.

Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI)

Catalog No. TMPH-00173

Copy Product Info

Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI)

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	-	In Stock
10 μg	$216	-	In Stock
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	-	In Stock

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 18.8 kDa and the accession number is O07623.
Species	Bacillus subtilis
Expression System	E. coli
Tag	N-6xHis-KSI
Accession Number	O07623
Synonyms	Subtilosin-A,sboA,sbo,Antilisterial bacteriocin subtilosin
Amino Acid	NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
Construction	9-43 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	18.8 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.