Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

ST3GAL3 Protein, Human, Recombinant (His & SUMO)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01105

Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc. ST3GAL3 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 54.9 kDa and the accession number is Q11203.

ST3GAL3 Protein, Human, Recombinant (His & SUMO)

ST3GAL3 Protein, Human, Recombinant (His & SUMO)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01105
Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc. ST3GAL3 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 54.9 kDa and the accession number is Q11203.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$7520 days20 days
10 μg$11920 days20 days
20 μg$19820 days20 days
50 μg$29720 days20 days
100 μg$42720 days20 days
200 μg$65820 days20 days
500 μg$1,17020 days20 days
1 mg$1,83020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc. ST3GAL3 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 54.9 kDa and the accession number is Q11203.
Species
Human
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberQ11203
Synonyms
ST3N,ST3GAL3,ST3Gal III (ST3GalIII),SIAT6,Sialyltransferase 6,N-acetyllactosaminide alpha-2,3-sialyltransferase,Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase,CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase,Beta-galactoside alpha-2,3-sialyltransferase 3 (Alpha 2,3-ST 3),4-galactoside alpha-2,3-sialyltransferase
Amino Acid
KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Construction
29-375 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight54.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

β-galactoside α-2,3-sialyltransferase 3 (α 2,3-ST 3)β-galactoside alpha-2,3-sialyltransferase 3 (Alpha 2,3-ST 3)β-galactoside a-2,3-sialyltransferase 3 (a 2,3-ST 3)α 2,3-ST3α 2,3-ST 3ST3GalIIIST3Gal IIIST3GAL 3SIAT 6Sialyltransferase6N-acetyllactosaminide α-2,3-sialyltransferaseN-acetyllactosaminide a-2,3-sialyltransferaseGal β-1,3(4) GlcNAc α-2,3 sialyltransferaseGal β-1,3(4) GlcNAc alpha-2,3 sialyltransferaseGal β-1,3(4) GlcNAc a-2,3 sialyltransferaseGal beta-1,3(4) GlcNAc α-2,3 sialyltransferaseGal beta-1,3(4) GlcNAc a-2,3 sialyltransferaseGal b-1,3(4) GlcNAc α-2,3 sialyltransferaseGal b-1,3(4) GlcNAc alpha-2,3 sialyltransferaseGal b-1,3(4) GlcNAc a-2,3 sialyltransferaseCMP-N-acetylneuraminate-β-1,4-galactoside α-2,3-sialyltransferaseCMP-N-acetylneuraminate-β-1,4-galactoside alpha-2,3-sialyltransferaseCMP-N-acetylneuraminate-β-1,4-galactoside a-2,3-sialyltransferaseCMP-N-acetylneuraminate-beta-1,4-galactoside α-2,3-sialyltransferaseCMP-N-acetylneuraminate-beta-1,4-galactoside a-2,3-sialyltransferaseCMP-N-acetylneuraminate-b-1,4-galactoside α-2,3-sialyltransferaseCMP-N-acetylneuraminate-b-1,4-galactoside alpha-2,3-sialyltransferaseCMP-N-acetylneuraminate-b-1,4-galactoside a-2,3-sialyltransferaseb-galactoside α-2,3-sialyltransferase 3 (α 2,3-ST 3)b-galactoside alpha-2,3-sialyltransferase 3 (Alpha 2,3-ST 3)b-galactoside a-2,3-sialyltransferase 3 (a 2,3-ST 3)Beta-galactoside α-2,3-sialyltransferase 3 (α 2,3-ST 3)Beta-galactoside a-2,3-sialyltransferase 3 (a 2,3-ST 3)Alpha 2,3-ST3Alpha 2,3-ST 3a 2,3-ST3a 2,3-ST 34-galactoside α-24-galactoside a-2