SPTA1 Protein, Human, Recombinant (His)

Name: SPTA1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02129
Rating: 4.5 (1 reviews)

(Synonyms: SPTA1, SPTA, Spectrin alpha chain, erythrocytic 1, Erythroid alpha-spectrin, erythrocytic 1) Copy Product Info

Synonyms: SPTA1, SPTA, Spectrin alpha chain, erythrocytic 1, Erythroid alpha-spectrin, erythrocytic 1

Catalog No. TMPH-02129 Copy Product Info

Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. SPTA1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 52.9 kDa and the accession number is P02549.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$219	20 days	20 days
10 μg	$365	20 days	20 days
20 μg	$613	20 days	20 days
50 μg	$1,160	20 days	20 days
100 μg	$1,890	20 days	20 days
200 μg	$2,890	20 days	20 days
500 μg	$5,160	20 days	20 days
1 mg	$7,960	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. SPTA1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 52.9 kDa and the accession number is P02549.
Species	Human
Expression System	HEK293 Cells
Tag	N-10xHis
Accession Number	P02549
Amino Acid	YHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQ
Construction	53-474 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	SPTA1, SPTA, Spectrin alpha chain, erythrocytic 1, Erythroid alpha-spectrin, erythrocytic 1
Research Background

Chemical Properties

Molecular Weight

52.9 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

SPTA 1Spectrin α chain, erythrocytic 1Spectrin a chain, erythrocytic 1Erythroid α-spectrinErythroid a-spectrinerythrocytic1

Related Tags: SPTA1 Protein, Human, Recombinant (His) chemical structure | SPTA1 Protein, Human, Recombinant (His) molecular weight