SPINK1 Protein, Mouse, Recombinant (His)

Name: SPINK1 Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02897
Rating: 4.5 (1 reviews)

(Synonyms: Spink3, Spink1, Serine protease inhibitor Kazal-type 3, Serine protease inhibitor Kazal-type 1, Prostatic secretory glycoprotein, P12) Copy Product Info

Synonyms: Spink3, Spink1, Serine protease inhibitor Kazal-type 3, Serine protease inhibitor Kazal-type 1, Prostatic secretory glycoprotein, P12

Catalog No. TMPH-02897 Copy Product Info

Purity: 98%

Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. SPINK1 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P09036.

SPINK1 Protein, Mouse, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$123	20 days	20 days
10 µg	$198	20 days	20 days
20 µg	$339	-	In Stock
50 µg	$497	20 days	20 days
100 µg	$696	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:98%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. SPINK1 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P09036.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P09036
Amino Acid	AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Construction	24-80 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Spink3, Spink1, Serine protease inhibitor Kazal-type 3, Serine protease inhibitor Kazal-type 1, Prostatic secretory glycoprotein, P12
Research Background	Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.

Chemical Properties

Molecular Weight

8.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.