Shopping Cart
- Remove All
- Your shopping cart is currently empty
Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $342 | 20 days | |
10 μg | $573 | 20 days | |
20 μg | $969 | 20 days | |
50 μg | $1,330 | 20 days | |
100 μg | $1,730 | 20 days |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2 μg/mL can bind Anti-SLC7A11 recombinant antibody, the EC50 is 9.452-13.79 ng/mL. |
Description | Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate. |
Species | Human |
Expression System | E. coli |
Tag | N-10xHis |
Accession Number | Q9UPY5 |
Synonyms | xCT,Solute carrier family 7 member 11,SLC7A11,Cystine/glutamate transporter,Calcium channel blocker resistance protein CCBR1,Amino acid transport system xc- |
Amino Acid | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL |
Construction | 1-501 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 58.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.