Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SLC5A5 Protein, Human, Recombinant (B2M & His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02121

May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. SLC5A5 Protein, Human, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 27.1 kDa and the accession number is O95436.

SLC5A5 Protein, Human, Recombinant (B2M & His)

SLC5A5 Protein, Human, Recombinant (B2M & His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02121
May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. SLC5A5 Protein, Human, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 27.1 kDa and the accession number is O95436.
Pack SizePriceAvailabilityQuantity
5 μg$7520 days
10 μg$11920 days
20 μg$19820 days
50 μg$29720 days
100 μg$42720 days
200 μg$65820 days
500 μg$1,17020 days
1 mg$1,83020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. SLC5A5 Protein, Human, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 27.1 kDa and the accession number is O95436.
Species
Human
Expression System
E. coli
TagN-6xHis-B2M
Accession NumberO95436
Synonyms
Solute carrier family 34 member 2,Sodium-phosphate transport protein 2B,Sodium-dependent phosphate transport protein 2B,Sodium/phosphate cotransporter 2B (Na(+)/Pi cotransporter 2B;NaPi-2b),SLC34A2,NaPi3b,Na(+)-dependent phosphate cotransporter 2B
Amino Acid
LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Construction
574-689 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight27.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords